PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G096000.1.p
Common NameSb08g014320, SORBIDRAFT_08g014320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ARF
Protein Properties Length: 840aa    MW: 92454 Da    PI: 6.7175
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G096000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.51.2e-23145246199
                           EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                           f+k+lt sd++++g +++ +++a+e+     +++++ +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F  
  Sobic.008G096000.1.p 145 FCKTLTASDTSTHGGFSVLRRHADEClppldMSQHPPNQELVAKDLHGIEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL- 232
                           99*****************************555555669************************************************. PP

                           -SSSEE..EEEEE-S CS
                    B3  85 dgrsefelvvkvfrk 99 
                            + +++el+v+v+r+
  Sobic.008G096000.1.p 233 -RGENGELRVGVRRA 246
                           .449999*****985 PP

2Auxin_resp111.21e-36271353183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++t+s+F+v+Y+Pr+s++eFvv+++++ ++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ ++dp+ W +SkWrsLk
  Sobic.008G096000.1.p 271 AWHAVNTGSMFTVYYKPRTSPAEFVVSRDRYYESLKRNYSIGMRFKMRFEGEEAAEQRFTGTIVGIGASDPSGWADSKWRSLK 353
                           89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.45E-41140274IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-40140260IPR015300DNA-binding pseudobarrel domain
CDDcd100171.69E-21143245No hitNo description
PfamPF023621.6E-21145246IPR003340B3 DNA binding domain
PROSITE profilePS5086311.646145247IPR003340B3 DNA binding domain
SMARTSM010191.4E-22145247IPR003340B3 DNA binding domain
PfamPF065077.3E-34271353IPR010525Auxin response factor
PROSITE profilePS5174524.101710794IPR000270PB1 domain
SuperFamilySSF542771.03E-10713786No hitNo description
PfamPF023091.8E-6757794IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MAAAAPAAGG GGGAEAGCGG GGGKDPLFVE LWKACAGPLS SVPPLGEKVY YFPQGHIEQV  60
EASTNQIAEQ QGTPLYNLPW KIPCKLMNIE LKAEPDTDEV YAQLTLLPDK KQDENTSTTV  120
ENEEAEEEVV PHAPPTNEGP RIHSFCKTLT ASDTSTHGGF SVLRRHADEC LPPLDMSQHP  180
PNQELVAKDL HGIEWRFRHI FRGQPRRHLL QSGWSVFVSA KRLVAGDAFI FLRGENGELR  240
VGVRRALRHQ TTIPSSVISS HSMHLGVLAT AWHAVNTGSM FTVYYKPRTS PAEFVVSRDR  300
YYESLKRNYS IGMRFKMRFE GEEAAEQRFT GTIVGIGASD PSGWADSKWR SLKVRWDEAS  360
SVPRPERVSP WQIEPAISPS PVNPLPVRFK RSRSSVNASP SDVPTVSREV ASKVMAESQQ  420
SNLPRALHNQ GRTQLTGRYH DSSDVKTAQD LTMWSSGTEQ QRNNIAAQTK RSLEGWTQSR  480
TPEGYNQLFS AFQPLKDTHN PLCTFPSQIS GTRSNTWDTA DARYPAQQAN HNMLHGTWPF  540
MPHSSGFRTN QQNYLVMPEA AKFTGKSAFT SLQGHGTDQC STGWFGHIES SSRTDHASSS  600
SIRPQPLVIG NDVQKTKGTS FKLFGIPLGS PEKSEPLVSP PSVAYDGKLQ TSPSEKGNQL  660
DIVGVDNCSD PSKTVKPFDG PQSDSITENN QPCPEATQNI QNKVQSSSTR SCKKVHKQGS  720
ALGRSIDLTK FTCYDELIAE LDQMFDFDGE LKNPCKNWLV VYTDNEGDIM LVGDDPWNEF  780
CDMVHKIFIY TREEVERMNP GALNSRSEDS LSDSQGRGLA SKEPPRGGPS TSTPNSESC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-168163758354Auxin response factor 1
4ldw_A1e-168163758354Auxin response factor 1
4ldw_B1e-168163758354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.102630.0embryo| leaf| ovary| panicle
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0670080.0BT067008.1 Zea mays full-length cDNA clone ZM_BFb0145N21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443175.10.0hypothetical protein SORBIDRAFT_08g014320
SwissprotQ2QQX60.0ARFX_ORYSJ; Auxin response factor 24
TrEMBLC5YNM80.0C5YNM8_SORBI; Auxin response factor
STRINGSb08g014320.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2